PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37616.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 311aa    MW: 35138.5 Da    PI: 6.0458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37616.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
       KHN37616.1 23 KGLWSPDEDERLIRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 70
                     678*******************************************97 PP

2Myb_DNA-binding538.2e-1776120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+v+++  lG++ W+ Ia++++ gRt++++k++w++ 
       KHN37616.1  76 RGAFSPQEEDLIVHLHSILGNR-WSQIAAHLP-GRTDNEIKNFWNST 120
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0281870IPR017930Myb domain
SuperFamilySSF466891.41E-2821117IPR009057Homeodomain-like
SMARTSM007171.4E-112272IPR001005SANT/Myb domain
PfamPF002495.9E-142370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-222477IPR009057Homeodomain-like
CDDcd001677.04E-102670No hitNo description
PROSITE profilePS5129425.94171125IPR017930Myb domain
SMARTSM007172.8E-1675123IPR001005SANT/Myb domain
PfamPF002492.7E-1576120IPR001005SANT/Myb domain
CDDcd001671.32E-1178121No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2678126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MRKPDLMANK DKVNNNIKSK LRKGLWSPDE DERLIRYMLT NGQGCWSDIA RNAGLQRCGK  60
SCRLRWINYL RPDLKRGAFS PQEEDLIVHL HSILGNRWSQ IAAHLPGRTD NEIKNFWNST  120
LKKRLKTNTS TPSLNNSTGS SESNKDVLSG IMPFSEHDIM TMCMDSSSSI SSMQATVLPD  180
QFDPFSMLAN NQCDMTNVSA DFPNLTQIGM VEGHEGNYGI LEPNKMGLGR DFSLPSLESR  240
SIESNSVPID VKSHNNHFNY GSFNHTDKIQ GSKVEDLIEF GNHGQGEDLK MGEWDLENLM  300
QDITSFPFLE F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-272112525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126LKKRLKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594415.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0B2RT730.0A0A0B2RT73_GLYSO; Transcription factor MYB46
STRINGGLYMA13G27310.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.18e-79myb domain protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]